Protein Info for GFF3283 in Sphingobium sp. HT1-2

Annotation: Peptide-methionine (R)-S-oxide reductase MsrB (EC 1.8.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 2 to 29 (28 residues), 17.3 bits, see alignment 4.6e-07 TIGR00357: methionine-R-sulfoxide reductase" amino acids 36 to 157 (122 residues), 154.9 bits, see alignment E=1.2e-49 PF01641: SelR" amino acids 44 to 157 (114 residues), 153.5 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 53% identical to MSRB_LEIXX: Peptide methionine sulfoxide reductase MsrB (msrB) from Leifsonia xyli subsp. xyli (strain CTCB07)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 71% identity to sch:Sphch_2317)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>GFF3283 Peptide-methionine (R)-S-oxide reductase MsrB (EC 1.8.4.12) (Sphingobium sp. HT1-2)
MNRRHFLYGVATGASALALWQFRPDAAEAAYPYRLTDAQWRSKLSPWAYKVLRQGATEFP
DSSPLNREHRAGTFTCAGCAQNLFSSKTKFDSGTGWPSFYAPLPRAIGTSRDFSLGVPRT
EVHCARCGGHLGHVFDDGPKPTGLRYCMNGVALAFSPA