Protein Info for GFF3281 in Xanthobacter sp. DMC5

Annotation: Cobalt-precorrin-5B C(1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01888: CbiD
  • amino acids 15 to 275 (261 residues), 290.6 bits, E=4.9e-91
• TIGR00312: cobalamin biosynthesis protein CbiD
  • amino acids 22 to 323 (302 residues), 167.5 bits, E=1.8e-53

Best Hits

Swiss-Prot: 65% identical to CBID_AGRFC: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 86% identity to xau:Xaut_3277)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (12/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (24/36 steps found)

Protein Sequence (377 amino acids)

>GFF3281 Cobalt-precorrin-5B C(1)-methyltransferase (Xanthobacter sp. DMC5)
MNTGDTADDASDRPLKRGWTTGTCAAGAAKAAFAALVSGDFPDPVEVELPSGARPAFALA
MHDHGSETATAGIVKDAGDDPDVTHGALVRATVRCGAAGAGITFKAGAGVGTVTRPGLPI
PPGEPAINPVPRRMIAAGIAEVAAAHGVAGDAEVEISIEDGATLALKTLNPRLGIVGGLS
VLGTTGIVVPYSCAAWIHSIHRGIDVARAMGLDHVAGATGSASEAAVAKLHALDEVALID
MGDFVGGMLKYVHAHPVPKVTVAGGVAKMTKLAQGFLDLHSKRGSADLPALARLAAEAGA
DADLCARIAGANMVAEAFQIAAAAGFPLGDCVARAAWGTAARALDRADVLLEITVFDRDG
ALMGRAPLLPAKGPARR