Protein Info for GFF3275 in Xanthobacter sp. DMC5

Annotation: Inner membrane transport permease YadH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 106 to 133 (28 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 10 to 220 (211 residues), 111.9 bits, see alignment E=3.3e-36 PF12698: ABC2_membrane_3" amino acids 59 to 245 (187 residues), 36 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 40% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 89% identity to xau:Xaut_3270)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF3275 Inner membrane transport permease YadH (Xanthobacter sp. DMC5)
VNLQVNLPAIRAIYTYEMNRTRRTIGQSIVSPVLSTSLYFVVFGSAIGSRMSEVGGVPYG
AFIVPGLMMLTLLTQSISNAAFAIYFPRFTGTIYELLSAPVSPFEIVAGYVGAAATKSVL
LGLIILATAALFVPMEVRHPFWMLTFLVLTAVTFSLFGFIIGIWADGFERLQLIPMLVIT
PLTFLGGTFYSLDMLPPVWRTVTLFNPVVYLVAGFRWSFFGTADVRVEVSAAMTLAFLIA
CLLIVRWMFRTGYRLKS