Protein Info for GFF3275 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR02296: 4-hydroxyphenylacetate 3-monooxygenase, reductase component" amino acids 10 to 162 (153 residues), 256.6 bits, see alignment E=3.9e-81 PF01613: Flavin_Reduct" amino acids 14 to 162 (149 residues), 115 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 100% identical to HPAC_SALTY: 4-hydroxyphenylacetate 3-monooxygenase reductase component (hpaC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00484, 4-hydroxyphenylacetate-3-hydroxylase small chain [EC: 1.14.13.3] (inferred from 98% identity to sty:STY1130)

MetaCyc: 85% identical to HpaC (Escherichia coli W)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.3

Use Curated BLAST to search for 1.14.13.3 or 1.5.1.36 or 1.6.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF3275 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQVDEQRLRFRDAMASLAAAVNIVTTAGHAGRCGITATAVCSVTDTPPSVMVCINANSAM
NPVFQGNGRLCINVLNHEQELMARHFAGMTGMAMEERFHQPCWQNGPLGQPVLNGALAGL
EGEISEVQTIGTHLVYLVAIKNIILSQDGHGLIYFKRRFHPVRLEMEAPV