Protein Info for GFF3273 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative two-component system response regulator YedW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR01387: heavy metal response regulator" amino acids 3 to 218 (216 residues), 349.7 bits, see alignment E=3.2e-109 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 99.2 bits, see alignment E=1.7e-32 PF00486: Trans_reg_C" amino acids 143 to 218 (76 residues), 93.8 bits, see alignment E=5.7e-31

Best Hits

Swiss-Prot: 76% identical to HPRR_ECOLI: Transcriptional regulatory protein HprR (hprR) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 99% identity to see:SNSL254_A1191)

Predicted SEED Role

"Putative two-component system response regulator YedW" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF3273 Putative two-component system response regulator YedW (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGW
QVLRALRTAHQSPVICLTARDSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVP
AFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLASRAGEIVPRTAIASEVWGIN
FDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRLQAETSQNG