Protein Info for PS417_16750 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00005: ABC_tran" amino acids 30 to 178 (149 residues), 112.1 bits, see alignment E=3.2e-36

Best Hits

Swiss-Prot: 49% identical to LOLD_PARXL: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02003, (no description) (inferred from 96% identity to pfs:PFLU3847)

MetaCyc: 37% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJL5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>PS417_16750 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MTDTPAHPGLISLQGIGKRYQLAGQHLSILNDVCLSIARGDSCGILGASGSGKSTLLNIL
GLLDLPNCGQYHFAGHDIFTATPDQLAAIRNQQIGFVFQSFNLLPRLSALDNVALPLSYR
GVSRHESVEQALRMLEQVGLADRAHHRPADLSGGQRQRVAIARALVGKPSVILADEPTGN
LDSTTAQDIMELLLTLNREQQVTLIIVTHDPHIAERLDRKILVRNGVVQEAGCP