Protein Info for GFF3271 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 176 (27 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 262 to 291 (30 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 341 to 469 (129 residues), 44.6 bits, see alignment E=1.4e-15 PF08447: PAS_3" amino acids 367 to 456 (90 residues), 63.8 bits, see alignment E=1.5e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 469 to 630 (162 residues), 150.9 bits, see alignment E=2.8e-48 PF00990: GGDEF" amino acids 473 to 628 (156 residues), 154.6 bits, see alignment E=2e-49

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>GFF3271 hypothetical protein (Xanthobacter sp. DMC5)
MQPVGPPTVKPPVPPAPDSPTGTDAPAFAPPGPPAPRGSAADLVTDLTLFALFYGGLLIA
FTEMGRRLGVYPAVWPTDALAVGVYFLMFRDAVGRLSAVVALVSIVVHLAAFGHDVGTAL
AAGCANALTFALVGWGCVRAGMERGALRSVPMVVSLGVVAVAGTLPGAIITAFVQFIDTN
GAFGPLLLRWWIPEMASVVLLLPPFLLWHGRAEDVGLRGSEGSRPKFSREEELAFASLTL
AASLVASAYYREPLLRDLGGAILLWFAFRLGLFATAVASSAYALAVLGLGMAQVWPQPLL
LTDLVATMLRLQARLVLVMLPALLIAAIMAQRSRQQREVQEDRRRLAYALEGANDGIWDW
HLPSDAVFFSARAHRMLGLDPDHAKKRLTDYGEVVHPEDLPAVAKSLKDHAEGRHLLFQA
EMRARHRNGSWLWVLVRGKIVERDPVGRPTRAVGTVTDISQRKHLEAALEHAASHDPLTG
LSNRAGFDRALEQARRRLVRDGALFAVVLIDIDYFKSVNDQHGHMAGDLLLTTAARRLQS
AIRAGDLVARYGGDEFAIIAAGKSREEFAAMADRLHKHLSRPVEVEGLALPSSFSLGMAV
ADDRTLDAAALIAEADAALYAAKDAGRGTWRAVGIAARTAEEAAHETPRRQMLPHSGLRA
DRRPPL