Protein Info for PS417_16715 in Pseudomonas simiae WCS417

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details PF07681: DoxX" amino acids 11 to 99 (89 residues), 66.7 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 76% identity to hse:Hsero_3241)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8B1 at UniProt or InterPro

Protein Sequence (135 amino acids)

>PS417_16715 DoxX family protein (Pseudomonas simiae WCS417)
MIQRLLPDALLLLVARVAIAAVFFLSGRTKVTGFLELKPSTYTLFRSEYALPLIPPDWAA
HLATYAEHLFPLLLVLGLLTRPAAAALLGMTLVIEVFVYPAAWPVHLTWAGLLLPLLAYG
GGAWSLDRLISGKRS