Protein Info for GFF3258 in Sphingobium sp. HT1-2

Annotation: 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 2 to 134 (133 residues), 148.5 bits, E=6.1e-48
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 3 to 132 (130 residues), 106.1 bits, E=7.8e-35

Best Hits

Swiss-Prot: 80% identical to RISB_SPHWW: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 87% identity to sch:Sphch_2368)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Protein Sequence (140 amino acids)

>GFF3258 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) (Sphingobium sp. HT1-2)
MAKFLIVEARFYDHLNDLLIEGAKAALDEAGHKYEVVTVPGALEIPGAIALAAETGRFDG
FVAIGVVIRGETYHFEVVSNESARGLMALSMDAIAIGNGILTVENEEQALVRARPDQKDK
GGEAAKAAIAMLGLRERFAI