Protein Info for GFF3254 in Variovorax sp. SCN45

Annotation: Phosphotransferase involved in threonylcarbamoyladenosine t(6)A37 formation in tRNA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF01636: APH" amino acids 47 to 271 (225 residues), 112.3 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 52% identical to AMGK_PSEAE: N-acetylmuramate/N-acetylglucosamine kinase (amgK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07102, (no description) (inferred from 90% identity to vpe:Varpa_5997)

Predicted SEED Role

"COG3178: Predicted phosphotransferase related to Ser/Thr protein kinases" in subsystem YjeE

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF3254 Phosphotransferase involved in threonylcarbamoyladenosine t(6)A37 formation in tRNA (Variovorax sp. SCN45)
MTAPLPPAPLAPSPAEPISWTDPKRAEVFRGWLEGIAPAHRLLPDTVRLASVDASFRRYF
RLDTTDPAAPTRIVMDAPPDKENSDPFVQVAKLMAEAGVLAPAVLEWDRPHGFLLLDDLG
RQTMLDVLDPARPDASRPLYDEAIDALIRWQLASKPGVLPPYDRALLERELALFPEWYIG
RHRGIAVEGKLKERLDRSFKLIVDSNLASPSVYVHRDFMPRNLMIGSGPKLGVLDFQDAV
YGPITYDIASLMRDAFLSWDEEFVLDITIRYWVAARKAGLPVDEDFGAFYRAVEWMGLQR
HLKVAGIFARITLRDGKPRYLADTPRFIAYIRATAGRYMELTPLVRVIDEIEGTSAITGF
AYGRV