Protein Info for GFF3253 in Xanthobacter sp. DMC5

Annotation: putative signaling protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 13 to 30 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 52 to 212 (161 residues), 95.3 bits, see alignment E=1.7e-31 PF00990: GGDEF" amino acids 54 to 210 (157 residues), 127 bits, see alignment E=6e-41 PF00563: EAL" amino acids 231 to 462 (232 residues), 242 bits, see alignment E=5.7e-76

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>GFF3253 putative signaling protein (Xanthobacter sp. DMC5)
MGEAHEAWHLDELFAAWIVATGALIAILIVREGQLRKLIIQQRETQKLVDDASAFDSLTG
IANRLQFQSEFGRELKEAWHKSTRLALLVVDVDLLRSVNEAHGHGAGDDLLRQLAARLVS
VPHRGGMVARLGSGEFAILFPMGSDETEELFRLASRILSRLREPFDCNGSRIDITASIGI
SKYPRDGSSATVLLQSAEKALRQAKAAGKDCYALYDSGLDARGRERRSLEAEFRHALEAG
EIVAQYQPVVRLATGETVGFEALARWRHPKRGILGPAEFIPIAEDEGLIDALFTAMLRRV
GEDLATWHMPLRVAVNLSPVQLVDPQLPQRILDLLAQMNIPPGQIELEITETGLLLDFET
ARGTLAVLKEAGVHVSLDDFGTGFSSLRHLNELPIDKIKIDRSFTRLIATEAQSCKIISS
MLNLGRTLELTTVAEGVETREEADFLLSQRCDLGQGYLFARPLWPQEAFAAASPSGA