Protein Info for GFF3249 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12840: HTH_20
  • amino acids 28 to 76 (49 residues), 28 bits, E=3.3e-10
• PF01022: HTH_5
  • amino acids 31 to 75 (45 residues), 42.7 bits, E=8.1e-15
• PF01638: HxlR
  • amino acids 34 to 89 (56 residues), 22.1 bits, E=2.2e-08
• PF12802: MarR_2
  • amino acids 39 to 79 (41 residues), 29.2 bits, E=1.6e-10

Best Hits

Swiss-Prot: 51% identical to BIGR_AGRFC: Biofilm growth-associated repressor (bigR) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 58% identity to rsc:RCFBP_11521)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Protein Sequence (107 amino acids)

>GFF3249 Transcriptional regulator, ArsR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNGQKTPSHTPEQLREHAGEACALLKALANEDRLMLLCQIAPGRQNVGELEEATGIRQPT
LSQQLAVLRQEGLVDTEKEGKFVYYRLTSDNVVRVMRTLWDIYCAPK