Protein Info for GFF3248 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 241 to 266 (26 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 25 to 288 (264 residues), 129.7 bits, see alignment E=5.9e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 55% identity to rsq:Rsph17025_3270)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF3248 hypothetical protein (Xanthobacter sp. DMC5)
MNRLILAFVLFAALAAVPAFADTAMLTLVARAMIFALAATSLGFILGQGGLVSFGHAATM
GIGAYAVGILMEEGVRDALVSFPVAMAAAGLFALVTGAISLRTRGVYFIMITLAFGQMAF
FVTQSLSAYGGDDGLSLAARSTVAGARWLKDPKTFHYVVLGLLACTVLVSTVLARAPFGR
VLAAGRDNERRLRALGVDPYAYRLVAYVIAGAFAGLAGALYANLTEFVSPAYLSWHRSAE
FIVMVVAGGPATALGPVLGALGVVLLEDGLAHLTEHWRIIFGPLLVLLVLARGGIATLLG
GRRDG