Protein Info for GFF3245 in Xanthobacter sp. DMC5

Annotation: Putative cysteine protease YraA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF01965: DJ-1_PfpI" amino acids 8 to 176 (169 residues), 182.5 bits, see alignment E=5.7e-58 TIGR01382: intracellular protease, PfpI family" amino acids 10 to 175 (166 residues), 181 bits, see alignment E=6.9e-58 PF18011: Catalase_C" amino acids 10 to 124 (115 residues), 32 bits, see alignment E=8.6e-12

Best Hits

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 78% identity to rpc:RPC_0982)

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF3245 Putative cysteine protease YraA (Xanthobacter sp. DMC5)
MPGPLDGKRILILSTNGFEQSELEVPRDRLKEAGAQVHVVSPEAGEIKGWDKKDWGRAVK
VDKTLSEARESDYDAIVLPGGQINPDLLRVEPAAITLIRSFYDAGKTVAAICHAPWLLVE
AGIAKGKRMTSYKSIRTDVENAGARWEDASVVTDSGVITSRNPGDLEDFSRKIIEEVREG
KHQRRAA