Protein Info for PS417_16610 in Pseudomonas simiae WCS417

Annotation: NADH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR01971: NADH-quinone oxidoreductase, chain I" amino acids 18 to 139 (122 residues), 174.1 bits, see alignment E=3.8e-56 PF00037: Fer4" amino acids 59 to 78 (20 residues), 22.3 bits, see alignment (E = 5e-08) amino acids 95 to 117 (23 residues), 35.1 bits, see alignment (E = 4.4e-12) PF13237: Fer4_10" amino acids 59 to 112 (54 residues), 31.9 bits, see alignment E=5.7e-11 PF12800: Fer4_4" amino acids 60 to 75 (16 residues), 16 bits, see alignment (E = 7e-06) amino acids 99 to 113 (15 residues), 15 bits, see alignment (E = 1.5e-05) PF12838: Fer4_7" amino acids 61 to 115 (55 residues), 45.3 bits, see alignment E=5.3e-15 PF13187: Fer4_9" amino acids 61 to 116 (56 residues), 28.2 bits, see alignment E=8.7e-10

Best Hits

Swiss-Prot: 100% identical to NUOI_PSEPF: NADH-quinone oxidoreductase subunit I (nuoI) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 97% identity to ppg:PputGB1_3698)

MetaCyc: 97% identical to NADH-quinone oxidoreductase subunit I (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U892 at UniProt or InterPro

Protein Sequence (182 amino acids)

>PS417_16610 NADH dehydrogenase (Pseudomonas simiae WCS417)
MFKYIGDIVKGTGTQLRSLVMVFGHGFRKRDTLQYPEEAVYLPPRYRGRIVLTRDPDGEE
RCVACNLCAVACPVGCISLQKAETEDGRWYPDFFRINFSRCIFCGLCEEACPTTAIQLTP
DFEMAEFKRQDLVYEKEDLLISGPGKNPDYNFYRVAGMAVAGKPKGAAQNEAEPINVKSL
LP