Protein Info for PS417_16605 in Pseudomonas simiae WCS417

Annotation: NADH:ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details PF00146: NADHdh" amino acids 17 to 322 (306 residues), 390.4 bits, see alignment E=3e-121

Best Hits

Swiss-Prot: 100% identical to NUOH_PSEFS: NADH-quinone oxidoreductase subunit H (nuoH) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to pfs:PFLU3824)

MetaCyc: 93% identical to NADH-quinone oxidoreductase subunit H (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0N1 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PS417_16605 NADH:ubiquinone oxidoreductase (Pseudomonas simiae WCS417)
MTWFTPEVIDVIISVVKAIVILLAVVVAGALLSFVERRLLGWWQDRYGPNRVGPFGMFQI
AADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAIIPITPTWGVADLNIGLLFFF
AMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLALMGIVVQVGSFNMRDIV
EYQAQNLWFIIPQFFGFCTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFV
GEYIGIILISALLVTLFFGGWHGPFGILPQLAFFWFFLKTAFFIMLFILLRASIPRPRYD
QVMDFSWRFCLPLTLINLLVTAAVVLLNTPAAAVQ