Protein Info for GFF3242 in Xanthobacter sp. DMC5

Annotation: Amino-acid carrier protein AlsT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 439 (427 residues), 493.5 bits, see alignment E=2.6e-152 PF01235: Na_Ala_symp" amino acids 49 to 451 (403 residues), 528.3 bits, see alignment E=7.4e-163

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 86% identity to xau:Xaut_1241)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF3242 Amino-acid carrier protein AlsT (Xanthobacter sp. DMC5)
MDAVIDFLNTIFWGYVLIYGLLAVGVYFTLRLGFVQIVHFPEMLRSVLRSNDTDKSGITP
FQALCTSLASRVGTGNIAGVAVALTLGGPGAIFWMWVVAALGMATAFAESTLAQLYKVKD
DEGRYRGGPAFYIAHGLKASWAGGLFSVCLIISFGLVFNAVQANSIADAVEGAFGVPKLG
TGLVVAVLSGVIIFGGIATIARTAEFVVPFMALAYVGLAFYALATHIALVPSVLGHIVGS
AFGVGAAAGGVAGSVAAAMMNGVKRGLFSNEAGMGSAPNIAAVATPDPHHPVSQGFVQSL
GVFIDTIVICTATALLILLSEVVPSAELTGTQLTQAALEVHVGWLGRYFVAIAIFFFAFT
SIIGNYSYAENALVFLGHGHVSGVIVLRLALLAMVVWGSLQSVATVFNAADASMGLMASI
NLVAIVLLSGTVVRLTKDYLAQRKAGTEPVFVADEMADLPPGVDRQIWSRK