Protein Info for GFF3242 in Sphingobium sp. HT1-2

Annotation: ATP phosphoribosyltransferase (EC 2.4.2.17) => HisGs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR00070: ATP phosphoribosyltransferase" amino acids 5 to 191 (187 residues), 193.6 bits, see alignment E=1.4e-61 PF01634: HisG" amino acids 56 to 211 (156 residues), 169.2 bits, see alignment E=3.5e-54

Best Hits

Swiss-Prot: 73% identical to HIS1_ZYMMO: ATP phosphoribosyltransferase (hisG) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 89% identity to sjp:SJA_C1-02800)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF3242 ATP phosphoribosyltransferase (EC 2.4.2.17) => HisGs (Sphingobium sp. HT1-2)
MTRPITFAIPKGRILEEALPLLAKAGIEPEAEFHDKKSRALRFATNRPDVSIIRVRAFDV
ATFVAHGAAQIGIVGSDVVDEFDYSELYAPVDLNIGHCRLSVAEPADAGDEDQAAMSHVR
VATKYPHLTRKYYEARGLQAECVKLNGAMELAPSLGLSRRIVDLVSSGATLKANGLVETA
IIMPVSARLIVNRAAYKMRSADLTTLVEAFRKAVEVRDAA