Protein Info for GFF324 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 111 (17 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF00015: MCPsignal" amino acids 329 to 471 (143 residues), 90.4 bits, see alignment E=6.2e-30

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 46% identity to swi:Swit_3822)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>GFF324 hypothetical protein (Sphingobium sp. HT1-2)
MAFNSLESLRLHGLRILLLCSLIWTVLIGIGGMMIGNERAAPAMLLSALANILPTWMVMR
RRNDLEVRLVMGTLAAVQPAITLFLLSGHVWQMDAHMYFFVALASLAVLYDWRPILLASV
LIALHHLVLTYVAPNWVFSGQAEIGRVIIHGFAVVLQGTILGYLSIKLHGLLLAQDAHVA
DTARLAREAQAGRNAAESAMDAQRQSDAREAHLRIERDAEKTRMAQDRRSETLALVGAFR
QSVAGVVSAVSAATGELKESAGLLHDLARRASVGTDETMAAAGQSSASAAVLARRIEQLS
ESISAIAAAASQQASLGGEAQRVSVAGHEAMQAMEGRTASITSFADSITEIAARTNLLAL
NATIEAARAGEVGRGFAVVAGEVKQLANQTASTTGEIQSLASSARQGAGVAQEALSEVAG
SVEELAQAAQAIQRAVADQRDATAAIGQSARDTARDADHMAQRMATVADVARNTENLSDR
VSSAAAGLSRTAQELQRATDLFVAQLEAA