Protein Info for GFF3236 in Sphingobium sp. HT1-2

Annotation: Prolyl oligopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02129: Peptidase_S15" amino acids 416 to 565 (150 residues), 58 bits, see alignment E=5.8e-19 PF00756: Esterase" amino acids 420 to 555 (136 residues), 22.5 bits, see alignment E=4.1e-08 PF20434: BD-FAE" amino acids 429 to 617 (189 residues), 56.2 bits, see alignment E=1.6e-18 PF12697: Abhydrolase_6" amino acids 439 to 572 (134 residues), 30.5 bits, see alignment E=2.6e-10 PF00326: Peptidase_S9" amino acids 454 to 660 (207 residues), 149.5 bits, see alignment E=4.5e-47 PF01738: DLH" amino acids 458 to 622 (165 residues), 36 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 74% identity to sjp:SJA_C1-02750)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>GFF3236 Prolyl oligopeptidase family protein (Sphingobium sp. HT1-2)
MFDWGVCLKPILSAAACALAAFAPAVSAQTDATKADAAKVSATTAKTWPIEAFAELPAMD
SPELSPDGARVAAWIAIKGVQQLVIAEVKGGNVRTMGLGENDLNWWRWVNNDWLIVGIGA
ETNVQGMPWSISRVASIKADGTKASILANAVAAQNGDDVIWVARDGSPRILLSYQTSIYY
DDLGFWPQVSEVDVSTGKMRTVVASRQYVRSWYADATGAVRMGVGYNDTARSSKLLYRPD
GRGSFRVVDKANRRRHESLIVPMLFTADPGKAIASDDRDGTDAFYELDLGTLELGKKLYE
APGFDLGGLEVDAAGTGMAGVRYTADAPAVHWFDPTLAKIQADIDKAVGDRRARIISTSQ
DLKKLIVHVGAASQPGAYYYYDTDYGAMSLLSKVSETLGVRPQLSPVKTIRYKARDGLEI
AAVLTLPYGKEAKNLPLILMPHGGPFARDAETWDWWVQFLANRGYAVIQPNYRGSSGYGT
EFAAKGEGQWGRAMQDDLNDAVDWAVKQGIADSKRVCVVGASYGGYAAMRAAQRDGGKYR
CAVSYAGVSDLGAMMRYDRRFLNSGASGDWLKEQAPDFAVVSPINYAAGFSTPILLMHGK
KDRRVPVGQSREMAEKLKAAGKVDGRDYIYVEQPLADHFFSRQADRLEFLQQLEAFLKAH
NPA