Protein Info for GFF3235 in Xanthobacter sp. DMC5

Annotation: Oxalate:formate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 107 to 134 (28 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details TIGR04259: oxalate/formate antiporter" amino acids 16 to 419 (404 residues), 655.2 bits, see alignment E=1.7e-201 PF07690: MFS_1" amino acids 29 to 270 (242 residues), 81.7 bits, see alignment E=2.5e-27 amino acids 262 to 413 (152 residues), 47.2 bits, see alignment E=7.6e-17

Best Hits

KEGG orthology group: K08177, MFS transporter, OFA family, oxalate/formate antiporter (inferred from 85% identity to xau:Xaut_1248)

Predicted SEED Role

"oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF3235 Oxalate:formate antiporter (Xanthobacter sp. DMC5)
MAQNSAAPVGGPIGGRWLQLLIGVVCMSMIANLQYGWTLFVEPMNEKHQWGRASIQVAFT
IFVLFETWLVPVEGWFVDKFGPRIVVFIGGILCALSWFLNSRADSLAMLYVSAALGGTGA
GAVYGTCVGSALKWFPDRRGLAAGITAAGFGAGSALTIVPIAAMIKSQGYEHTFLFFGLL
QGAVVVALSLLLQAPKEGQLPVVKASATQSRRNYGPGEMVKAPVFWVMYLMFVLVAAGGL
MATAQLGSIAKDFKIADVPVSILGLTMPALTFALSIDRVLNGLTRPFFGWVSDNIGRENT
MFIAFGLEAVGVLALAHFGSNPVLFVLLTGLVFFAWGEIYSLFPATCGDTFGGKFATTNA
GLLYTAKGTASLVVPMASVAVASLGNWDLVFMITAAVNAIAALMAIFVLKPMRTRFVAGA
AAQAAAEPASAKVTG