Protein Info for GFF3228 in Xanthobacter sp. DMC5

Annotation: N5-carboxyaminoimidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22660: RS_preATP-grasp-like
  • amino acids 8 to 102 (95 residues), 109.5 bits, E=1.4e-35
• TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit
  • amino acids 8 to 361 (354 residues), 391.3 bits, E=2.4e-121
• PF02222: ATP-grasp
  • amino acids 110 to 289 (180 residues), 193.1 bits, E=5.2e-61
• PF17769: PurK_C
  • amino acids 310 to 361 (52 residues), 60.7 bits, 1.3e-20

Best Hits

Swiss-Prot: 52% identical to PURK_BRUME: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 88% identity to xau:Xaut_1255)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Protein Sequence (370 amino acids)

>GFF3228 N5-carboxyaminoimidazole ribonucleotide synthase (Xanthobacter sp. DMC5)
MLKPGSVIGILGGGQLGRMIALAAAELGLKAHVLCPDKDSPAFHVSAAHICAAYDDFDAL
ARFAAGVDVVTYEFENVPLATAEFLAARVPLRPGAKALAITQDRLAEKSFVRDLGIETAP
FAPVDSLADLEAAVAQLGVPAVLKTRRFGYDGKGQVMIRPGEDLTAAWHALGRQSAILEG
FVSFVREVSVVAARRGDGAFCAYDVTENVHREHILHTSTVPATLTAEAGRKARAIARDIG
DALEYEGVFAVELFVVCQGSNERVIVNEIAPRVHNSGHWTQDGAVTSQFEQHVRAIAGWP
LGEVSRLGRAQMTNLIGADVHDWHALLAEPGTHLHLYGKEEARAGRKMGHVVRVLRDPEA
CANIPDGEGC