Protein Info for GFF3217 in Xanthobacter sp. DMC5

Annotation: Cytochrome bd-I ubiquinol oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 5 to 217 (213 residues), 159.7 bits, see alignment E=6.2e-51 PF02322: Cyt_bd_oxida_II" amino acids 5 to 323 (319 residues), 333.2 bits, see alignment E=7.8e-104

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 88% identity to xau:Xaut_1267)

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF3217 Cytochrome bd-I ubiquinol oxidase subunit 2 (Xanthobacter sp. DMC5)
MEWYLPVIWGLIIGVAVIMYVVLDGFDLGIGILFPFAKEEKERDVMMNTVAPFWDGNETW
LILGGGGLWVAFPKAYAVVMPALYLPVIIMLLALVFRGVAFEFRWVAASSRRLWNFAFSA
GSLVAAFFQGIILGGLVQGITVKDGAFAGGPLDWATPFALLCGVGVVVGYALLGATWLLV
KTEGVIADRARSHAIPLLLAVVVLMGLVSLWTPLAFDRIATRWFSRPNIFFLAPVPIITA
GLTYLVWHWLKTGREMLPFFGTIGLFVLGFLGLAISTFPYLVPPSLTVWQTAAAPPSQIL
MLFGVIFLLPVVLGYIVFVYWIFRGKVREGEGYH