Protein Info for GFF3216 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 399 to 423 (25 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 8 to 434 (427 residues), 547.6 bits, see alignment E=7.9e-169

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 90% identity to xau:Xaut_1268)

MetaCyc: 52% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF3216 hypothetical protein (Xanthobacter sp. DMC5)
MDFDPVTLARMQFAFTVSFHVIFPAFTIGLSAFIATLELIWLKTGKDVFHRLARFWTKIF
AVSFAMGVVSGIVLSYQFGTNWSRYAEFVGSVIAPLIGFEVLTAFFLEATFLGIMLFGWN
RVPPWLHVLSCCVVAFGTFMSAFWILAANSWMQTPAGYEIRNGVGYPLDWLEIIFNPSFH
WRLPHMLLAAYLTTSLVVLSVGARYLLAGKFKDESKVMMVMGIGMLAIVGPIQAFVGDSH
GLNTAHYQPAKIAAVEAHWDSTKPAPLVLFAWPDEKAEKNLFEISIPHGASLMITHSLDG
LFPGLKDFPPQDRPPVFGPFFGFRAMVGVGVVMILLGWIGAWLIFKGRETTTRWYLVVTS
WAWPLGFIAILSGWIVTEQGRQPWVVEGLLRTEDAMSPLAGWTVGLSLTLFIIIYAVIFA
TGIHFMNRLIVRGPDQTLIQPPARELPTRPIAAAHGEGQMTPGT