Protein Info for GFF3215 in Xanthobacter sp. DMC5

Annotation: Riboflavin transporter RibZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details amino acids 477 to 498 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 49 to 452 (404 residues), 238.4 bits, see alignment E=7.3e-75 PF07690: MFS_1" amino acids 50 to 444 (395 residues), 172.5 bits, see alignment E=1.2e-54 PF00083: Sugar_tr" amino acids 99 to 218 (120 residues), 26 bits, see alignment E=4.4e-10

Best Hits

KEGG orthology group: None (inferred from 63% identity to msl:Msil_1009)

Predicted SEED Role

"drug resistance transporter, EmrB/QacA subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>GFF3215 Riboflavin transporter RibZ (Xanthobacter sp. DMC5)
MEQGLPGSAAADGSARRPLRARLARLTHEPAPLAALEALPWHSWIVVGLVCIGAFVGQLD
ATIVQLALPTLATTFDAGLHAVSWVSLGYLVAFASFLPIFGRLCQMYGRKTLYLLGYLVF
VAASALCALAPDLPSLVAARVVQGIGGALLGANSIAILIAAVPEEKRGRALGVFAAAQAI
GMSAGPAVGGIVLGALGWPWIFWLTVPFGILAAIAGWIALPRTRGAPPEARFDWLGALLL
APALVILVRALNHAAGWGLTSPETIGSVILSAGLIWLLVRQERRAAFPLVDLKLFANPGF
ALGAGAVVLGYAMLYAMFFLMSFLLEHGYGEQAWAAGLRLAIIPVILGLVAPFSGALADR
LGIRLLGASGMGVCLLGLLVLGLGVGDPAASRLMSFVAFLLFGAGLGLFIAPNNHDTLKA
APPELATQAGSLLNLMRVLGTSLGVAGATSTLSLGLKQAGGLTDRMKDVSGPALVNAVEW
GIVLVAIMALIAALLCVLRHRRS