Protein Info for PS417_16450 in Pseudomonas simiae WCS417

Annotation: sulfurtransferase TusE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 5 to 111 (107 residues), 141.8 bits, E=4.7e-46
• PF04358: DsrC
  • amino acids 6 to 111 (106 residues), 125.9 bits, E=4.5e-41

Best Hits

Swiss-Prot: 52% identical to TUSE_HAEIN: Sulfurtransferase TusE homolog (tusE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 91% identity to pfs:PFLU3793)

MetaCyc: 47% identical to DsrC monomer (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (3/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

See U1U9M4 at UniProt or InterPro

Protein Sequence (111 amino acids)

>PS417_16450 sulfurtransferase TusE (Pseudomonas simiae WCS417)
MNTLTVGARTLELDKDGYLAHLDDWSADVANALAAAEALELTEAHWEILELLRQFYAEFQ
LSPATRPLIKYTALKLGPEKGNSLHLNKLFNGTPAKLAAKLAGLPRPTNCL