Protein Info for GFF3212 in Sphingobium sp. HT1-2

Annotation: Na(+)/H(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 225 to 259 (35 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 392 (380 residues), 132.1 bits, see alignment E=2.5e-42 PF02254: TrkA_N" amino acids 406 to 485 (80 residues), 25 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 75% identity to npp:PP1Y_Mpl9635)

Predicted SEED Role

"Na(+):H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>GFF3212 Na(+)/H(+) antiporter (Sphingobium sp. HT1-2)
MVPAMHEQALVIALIGILGIGAQWIAWRTGWPAIALMLAAGVIGGPVTGLIDPKLTFGEL
LEPMVSVAVALILFEGGLSLNFRELRKTDGAVTRLVVLGAPIGWILGALALYYVAGLVWP
VAILFAGILVVTGPTVVLPLLRQSNVAARPRAILKWEAIVNDPVGALLGLATYEYLRRSS
EGSTLAAVILSLVAAAIIAGLIGWLAARAIGWAFQRGHVPEYLKAPILLVAVIGVFVLSN
LIQAETGLVTVTVMGVALANMKFDSLRDIQPFKENVTVLLISGVFVILSASLDLDVLRQF
EWRFLAYLLVLLFVVRPATVLLSLAFSPVPWNERLLVAWIAPRGIVAVAISGLFALRLDR
LGYGDGAILVTLSFSIVVATILFHGFSIKPVARLLKVTGAQDKGLLLVGATPFSLSLAAQ
LRQLEVPVMIADNSWQRLAPARHGGIPTYHGEILAEATEERLDLTQFQVLAATSENEAYN
ALVCNEFAPEVGRDNVYQLGDASDDHDPRALPESLRGRALFDSGLGVEEIMIREDAGWTF
RKTRISDQFDFEAAKADLPANADMLLLLRKNGTMRFFTHASRPTPQPGDTILSYVPPASK
TRKKPEGEEE