Protein Info for PS417_16415 in Pseudomonas simiae WCS417

Annotation: tRNA 2-thiocytidine biosynthesis protein TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF01171: ATP_bind_3" amino acids 34 to 198 (165 residues), 53.3 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 98% identical to TTCA_PSEPF: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 98% identity to pfs:PFLU3786)

MetaCyc: 69% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U304 at UniProt or InterPro

Protein Sequence (274 amino acids)

>PS417_16415 tRNA 2-thiocytidine biosynthesis protein TtcA (Pseudomonas simiae WCS417)
MGTLTVNQNKLQKRLRRLAGEAVADFNMIEDGDKVMVCLSGGKDSYTMLDVLLHLQKVAP
ITFEIVAVNMDQKQPGFPEHVLPAYLKALGVEYHIVEKDTYSVVKELIPEGKTTCSLCSR
LRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGSLKAMPPKLRADDGRNVVIRP
LAYCNEKDIQAYSDFKQFPIIPCNLCGSQENLQRQVVKEMLVDWERKTPGRTESIFRSLQ
NVIPSQLADRNLFDFTSLKIDETAASRFVNVVNL