Protein Info for GFF3205 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details amino acids 459 to 478 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 96% identical to DLST_ECOLI: Probable serine transporter (dlsT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to spq:SPAB_04042)

MetaCyc: 96% identical to L-cysteine importer (Escherichia coli K-12 substr. MG1655)
RXN-23966

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>GFF3205 Serine transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIFLLQESTCTSRSAYRLAAARKIKKTSTYTLSENFMESASNTSVILDASAPARRAGMTE
SEWREAIKFDSTDTGWVIMSIGMAIGAGIVFLPVQVGLMGLWVFLLSSIIGYPAMYLFQR
LFINTLAESPECKDYPSVISGYLGKNWGILLGALYFVMLVIWMFVYSTAITNDSASYLHT
FGVTEGLLSDSPFYGLVLICILVAISSRGEKLLFKISTGMVLTKLLVVAALGVSMVGMWH
LYNIGALPPMALLIKNAIITLPFTLTSILFIQTLSPMVISYRSREKSIEVARHKALRAMN
IAFGILFVTVFFYAVSFTLAMGHDEAVKAYEQNISALAIAAQFISGDGAGWVKVVSVILN
IFAVMTAFFGVYLGFREATQGIVMNILRRKMPAEKIKENLVQRGIMIFAILLAWSAIVLN
APVLSFTSICSPIFGMVGCLIPAWLVYKVPALHKYKGASLYLIIITGLLLCVSPFLAFS