Protein Info for GFF3204 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 44 to 79 (36 residues), see Phobius details amino acids 91 to 106 (16 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 182 to 209 (28 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 486 to 505 (20 residues), see Phobius details amino acids 531 to 553 (23 residues), see Phobius details amino acids 572 to 596 (25 residues), see Phobius details amino acids 608 to 631 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 293 (285 residues), 99.2 bits, see alignment E=1.2e-32 amino acids 362 to 619 (258 residues), 106.6 bits, see alignment E=6.5e-35

Best Hits

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>GFF3204 hypothetical protein (Xanthobacter sp. DMC5)
MQLLFVEQLLNGVQLGVILFLMAAGLTLTFGIMNLVNLAHGSLFMLGAYLGVAFGLVTGS
FVAGFVAAGLATFVIGLVLERLVIRHLYARSHLDQVMCTVGLVYVLNEATRMVFGPEPLH
APIPAFLAGSVELIPGAPYPAYRLAMIGAGLAIAGLLYVLIGRTRMGMLIRAGASNRVMT
SVLGVNIGAIYAVVFGIGAALAGFAGYIAAPILTVYPGMGDNVLILALVVLVVGGMGSVK
GAFVAALLVGVIDTIGRAYLKDLMALVLSPVAANTVAPALASMLIYILMAVILFFRPQGL
IPAAGLRRPEAPPEASDHGPNGPGVLARWRVPAIGLLGGAFLLLPLVAGLADQPFWVDMG
LRVIIFAIAALSLDLILGQTGLVSFGHALYLGIGAYVVGILADAGVESGFVQWPLAMAIS
ALLAAALSVVALRTSGTFFIMITLAFAQMMFYGASSLYDYGGDDGMHLAVRSTFGGLVDL
YDSRQFYYLALAVLVVLAGLNIRLARARFGTVLKGIRINERRMEAAGFPTFRYKLAACVL
SAAVCGLAGAMLANAAEFVGPQYMDWTRSAELMIMVVAGGLATPFGAIIGALAYLGIEKY
LSDLTIHWRLGFGALLILLVFLGRGGLSALFAPGPAGQPTPVHKGSFRWARPFFRPRA