Protein Info for GFF3204 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 319 to 340 (22 residues), see Phobius details PF03313: SDH_alpha" amino acids 92 to 428 (337 residues), 190.7 bits, see alignment E=2e-60

Best Hits

Swiss-Prot: 100% identical to YHAM_SALTY: UPF0597 protein YhaM (yhaM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sek:SSPA2900)

MetaCyc: 84% identical to L-cysteine desulfidase (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]

Predicted SEED Role

"Inner membrane protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF3204 Inner membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFESKINPLWQSFILAVQEEVKPALGCTEPISLALAAAAAAAELNGTVERIDAWVSPNLM
KNGMGVTVPGTGMVGLPIAAALGALGGDAKAGLEVLKDASAKAVADAKAMLAAGHVAVML
QEPCNDILFSRAKVYSGDSWACVTIVGDHTNIVRIETDKGVVFTQADNAQEEEKTSPLGV
LSHTSLEEILAFVNAVPFDAIRFILDAARLNGALSQEGLRGSWGLHIGSTLAKQCDRGLL
AKDLSTAILIRTSAASDARMGGATLPAMSNSGSGNQGITATVPVMVVAEHVGADDERLAR
ALMLSHLSAIYIHHQLPRLSALCAATTAAMGAAAGMAWLIDGRYDTIAMAISSMIGDVSG
MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHNVEQSISNLCSLACRSM
QQTDKQIIEIMASKAH