Protein Info for GFF3204 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03313: SDH_alpha
  • amino acids 92 to 428 (337 residues), 190.7 bits, E=2e-60

Best Hits

Swiss-Prot: 100% identical to YHAM_SALTY: UPF0597 protein YhaM (yhaM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sek:SSPA2900)

MetaCyc: 84% identical to L-cysteine desulfidase (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]

Predicted SEED Role

"Inner membrane protein"

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-threonine metabolism (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• glycine betaine degradation III (4/7 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• superpathway of L-methionine salvage and degradation (4/16 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.28

Protein Sequence (436 amino acids)

>GFF3204 Inner membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFESKINPLWQSFILAVQEEVKPALGCTEPISLALAAAAAAAELNGTVERIDAWVSPNLM
KNGMGVTVPGTGMVGLPIAAALGALGGDAKAGLEVLKDASAKAVADAKAMLAAGHVAVML
QEPCNDILFSRAKVYSGDSWACVTIVGDHTNIVRIETDKGVVFTQADNAQEEEKTSPLGV
LSHTSLEEILAFVNAVPFDAIRFILDAARLNGALSQEGLRGSWGLHIGSTLAKQCDRGLL
AKDLSTAILIRTSAASDARMGGATLPAMSNSGSGNQGITATVPVMVVAEHVGADDERLAR
ALMLSHLSAIYIHHQLPRLSALCAATTAAMGAAAGMAWLIDGRYDTIAMAISSMIGDVSG
MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHNVEQSISNLCSLACRSM
QQTDKQIIEIMASKAH