Protein Info for PS417_16395 in Pseudomonas simiae WCS417

Annotation: arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 TIGR00014: arsenate reductase (glutaredoxin)" amino acids 5 to 116 (112 residues), 144.3 bits, see alignment E=1.1e-46 PF03960: ArsC" amino acids 7 to 115 (109 residues), 80.7 bits, see alignment E=4.1e-27

Best Hits

Swiss-Prot: 62% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 97% identity to pfs:PFLU3782)

MetaCyc: 43% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJF2 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PS417_16395 arsenate reductase (Pseudomonas simiae WCS417)
MTDLTLYHNPRCSKSRGALELLEARGLTPTVVRYLETPLDAAQLKALLGKLGISARQLLR
TGEDEYKTLNLADASLSEAQLIAAIAEHPKLMERPILETADTAIIGRPPENVLEILP