Protein Info for GFF32 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 28 to 162 (135 residues), 114.5 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 43% identical to SSUB2_STRAW: Aliphatic sulfonates import ATP-binding protein SsuB 2 (ssuB2) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 58% identity to pgv:SL003B_0792)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF32 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSFNDHGASPLRLDGVSKRYGNQTLAIDNVSFALERGSFTSLLGPSGCGKSTLLRLMAGL
GEATQGKVTRPTRRGAISFVFQEPTLMPWASALSNAMKPLTLTGTPRAEAQARAMAALEQ
VGLKGFEHAYPRELSGGMKMRVSIARALATDPEVLLLDEPFAALDEITRFKLNNDLLALW
QQKRFTAVFVTHSVFESVYLSQRVLVLAARPGRLHSDILIDSASERTETFRTSGEYAQLC
REASAALESAMFAHAAPR