Protein Info for GFF3193 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized protein YqjB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF13721: SecD-TM1" amino acids 10 to 105 (96 residues), 69.9 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 99% identical to MZRA_SALA4: Modulator protein MzrA (mzrA) from Salmonella agona (strain SL483)

KEGG orthology group: None (inferred from 99% identity to seg:SG3123)

Predicted SEED Role

"Uncharacterized protein YqjB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>GFF3193 Uncharacterized protein YqjB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLKPRITARQLIWISAFLLMLTILMMTWSTLRQQESTLAIRAVNQGASMPDGFSVLHHLD
ANGIHFKSITPKNDMLLITFDSPAQSAAAKTVLDQTLPHGYVVAQQDDDNETVQWLSRLR
ESSHRFG