Protein Info for PS417_16335 in Pseudomonas simiae WCS417

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 19 to 326 (308 residues), 361.4 bits, E=2.1e-112
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 27 to 315 (289 residues), 266.4 bits, E=1.7e-83

Best Hits

Swiss-Prot: 94% identical to LPXK_PSEFS: Tetraacyldisaccharide 4'-kinase (lpxK) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 94% identity to pfs:PFLU3772)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (17/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See A0A1N7UDF4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PS417_16335 tetraacyldisaccharide 4'-kinase (Pseudomonas simiae WCS417)
MAMSDRLLKAWYEGHPALTLLRPLESLYRGVVQRKRARFLAGEGEIYQSPVPVVVVGNIT
VGGTGKTPLILWLIEHCRRSGLRVGVVSRGYGAKPPQLPWRVEASHSAEVAGDEPLLIVQ
RCGVPLVIDPNRSHAVQALLASETVDLILSDDGLQHYRLARDLELVLIDAARGLGNRRCL
PAGPLREPVERLQSVDALLYNGAVSDRDDGFAFRLQPTALVNLLTGERQPVDHFPAGQPV
HAVAGIGNPQRFFNTLETLHWQPIPHAFADHAPYSAEVLNFTPSLPLVMTEKDAVKCRAF
AQPDWWYLAVDALPSRAFIAWFDTQLMRLLPARLLP