Protein Info for GFF3187 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: COG1451: Predicted metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF01863: YgjP-like" amino acids 93 to 149 (57 residues), 42.9 bits, see alignment E=3e-15

Best Hits

Swiss-Prot: 88% identical to UTPP_ECOLI: UTP pyrophosphatase (ygjP) from Escherichia coli (strain K12)

KEGG orthology group: K07043, (no description) (inferred from 99% identity to sei:SPC_3297)

Predicted SEED Role

"COG1451: Predicted metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF3187 COG1451: Predicted metal-dependent hydrolase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTSLTYLQGYPEHLLAQVRALIAEQRLGAVLEKRYPGAHDYATDKALYHYTQELKSQFLR
NAPPINKVMYDSKIHVLKNALGLHTAVSRVQGGKLKAKAEIRVATVFRNAPEPFLRMIVV
HELAHLKEKDHNKAFYQLCCHMEPQYHQLEFDTRLWLTHQALSAQ