Protein Info for GFF3184 in Xanthobacter sp. DMC5
Annotation: 4-hydroxybenzoyl-CoA reductase subunit gamma
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 33% identical to XDHC_ECOLI: Putative xanthine dehydrogenase iron-sulfur-binding subunit XdhC (xdhC) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 78% identity to msl:Msil_1275)MetaCyc: 33% identical to putative xanthine dehydrogenase iron-sulfur-binding subunit XdhC (Escherichia coli K-12 substr. MG1655)
Xanthine dehydrogenase. [EC: 1.17.1.4]; 1.17.1.4 [EC: 1.17.1.4]
Predicted SEED Role
No annotation
MetaCyc Pathways
- adenosine nucleotides degradation II (4/5 steps found)
- guanosine nucleotides degradation II (3/4 steps found)
- guanosine nucleotides degradation III (3/4 steps found)
- inosine 5'-phosphate degradation (3/4 steps found)
- purine nucleotides degradation II (aerobic) (8/11 steps found)
- adenosine nucleotides degradation I (5/8 steps found)
- guanosine nucleotides degradation I (2/4 steps found)
- ureide biosynthesis (4/7 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
- purine nucleotides degradation I (plants) (7/12 steps found)
- superpathway of purines degradation in plants (9/18 steps found)
- caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
- theophylline degradation (1/9 steps found)
- caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.17.1.4
Use Curated BLAST to search for 1.17.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (171 amino acids)
>GFF3184 4-hydroxybenzoyl-CoA reductase subunit gamma (Xanthobacter sp. DMC5) LPPVSLTINGRSHGPIEVREGLSMNDFLREVLGMTGTKFGCGAAQCLSCAVIVDHADGTS STTPTCIAPATDFDTLAIRTVEGHAKNGELTPLQKSFVAHFAFQCGYCTPGFLNEGQVLL ERLERAPIPRADLERTIAEALDGHLCRCSGYVKYHQAVRDVVLADPKRFLT