Protein Info for GFF3184 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details PF03707: MHYT" amino acids 2 to 58 (57 residues), 57.8 bits, see alignment 1.3e-19 amino acids 66 to 112 (47 residues), 47.3 bits, see alignment 2.6e-16 amino acids 133 to 178 (46 residues), 27.9 bits, see alignment 2.9e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 216 to 384 (169 residues), 130.2 bits, see alignment E=3.1e-42 PF00990: GGDEF" amino acids 220 to 379 (160 residues), 154.5 bits, see alignment E=3.2e-49 PF00563: EAL" amino acids 401 to 635 (235 residues), 248.8 bits, see alignment E=7.1e-78

Best Hits

KEGG orthology group: None (inferred from 62% identity to aav:Aave_1490)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>GFF3184 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MGTGIWSMHFVGMLGFSLPISLGFSGGLTLASWVAGVMASGVALWVASEADYGLRRIAIA
SLAMAVGICGMHYIGMAALDMAPPIVWHVPTVLVSLLIGLGASAAALVIFKYLGNAHSTY
RVAFQLLASVVMGIAICGMHYTGMAAANFPADSVCLSSGQLYGTGLTAIVGLASGLLLLG
TLFTSILESRLQLVARRLSSSLEEANAELTQANHELQKRAFTDALTGLPNRVLFEDRLRH
ALARMNRANQLQVEECIAVLFVDLDGFKPINDSFGHSAGDRILCVAAERLARNTRESDTV
ARIGGDEFLLLLEGVHDRAECAEAANRVLRALGEPFNVQGKLLQIACSIGIVLHPEQGEP
DKLVANADAAMYEAKRAGGGNYVMFESHMGADAAKQLQLQSDLRRAVELKQFELYYQPKI
NGVGDSISGVEALVRWNHPQHGLIGPTEFIGLAERFGLIVHLGDWILDEACRQIAQWQAQ
GTQMCVAVNLSVMQLREVDFVARVERALLRHNVPASLLLCEITESVAMEDIKATQRTLEG
LARVGVFLSIDDFGTGYSSLSHLRKLPARQVKIDRSFVQDLQTKEDARAVIDAVIRLAHA
LGLSVVAEGVENEAQRDILLAMGCDELQGFLFSRPLPAGDLLDWFSNRYAEAA