Protein Info for GFF3181 in Variovorax sp. SCN45

Annotation: FIG005069: Hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 195 to 225 (31 residues), see Phobius details PF06966: DUF1295" amino acids 23 to 251 (229 residues), 233.3 bits, see alignment E=4.3e-73 PF02544: Steroid_dh" amino acids 142 to 203 (62 residues), 25.1 bits, see alignment E=2.4e-09

Best Hits

KEGG orthology group: None (inferred from 81% identity to vpe:Varpa_4423)

Predicted SEED Role

"FIG005069: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF3181 FIG005069: Hypothetical protein (Variovorax sp. SCN45)
MSGMVGLALAGLVLTASLAFLTWLASLARHDASLIDRMWPVYIVGAGLVYFVLLPVQTVR
GLCMAVLGAAWAVRLCLYITWRNWGHGEDRRYQAIRARNQPNFGFKSLYLVFALQAVLAW
VVSAPFLPGAAAARPLGALDALGILLALFGIFFEAIGDAQMARFRAEPKNKGQVMDRGLW
RYTRHPNYFGEACVWWGLWLLAIGGAGWGGAWSVVSPLLMTWLLLKVSGVSMLEGDIGER
RPAYRDYIARTNAFVPGPVRADHHKAP