Protein Info for GFF3180 in Sphingobium sp. HT1-2

Annotation: Protein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 27 (3 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 471 to 490 (20 residues), see Phobius details amino acids 496 to 519 (24 residues), see Phobius details PF07549: Sec_GG" amino acids 44 to 63 (20 residues), 22 bits, see alignment (E = 2.3e-08) TIGR01129: protein-export membrane protein SecD" amino acids 46 to 519 (474 residues), 451.4 bits, see alignment E=3.1e-139 PF21760: SecD_1st" amino acids 159 to 217 (59 residues), 90.1 bits, see alignment 1.3e-29 PF22599: SecDF_P1_head" amino acids 245 to 350 (106 residues), 135 bits, see alignment E=2.8e-43 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 282 to 512 (231 residues), 243.8 bits, see alignment E=1.7e-76 PF02355: SecD_SecF_C" amino acids 351 to 518 (168 residues), 58 bits, see alignment E=2.2e-19 PF03176: MMPL" amino acids 399 to 515 (117 residues), 29.1 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 90% identity to sjp:SJA_C1-05880)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>GFF3180 Protein translocase subunit SecD (Sphingobium sp. HT1-2)
MLNFSRWAIAGILLPLIIGIFCAVPSFLPDSTVAKLPPFMQTRVNLGLDLAGGSHLLLEA
STQDVAKQRLANMEEQVRTELRRGETKIAIGDISSRDGKLSFMVRNPSEVDAAVERIRPL
TQGAGLTGQRDFNVEVVNSSTIVITPTQAGIDNAVKSAMQVATEVIRKRIDEMGTREPTI
QQQGANRIVVQVPGLQDPKALKALLGQTAKLEFKLVDMSANPSEVAQGRAPVGSEVLPYP
TNPAGPPMIAVHRQVMVSGEELTDAQQTYDQQTNEPNVTIRFNGSGGNKFAKVTSQNVNR
PFAIILDGKVLSAPNINEPILGGSATISGSFTVEGANQLAIALRSGKLPVNFVVVEERTV
GPGLGADSIRAGLVASIVAVVAVAAFMFVSYGRFGMYANLAVAINVLVILGVMGILGATL
TLPGIAGFVLTIGTAVDANVLIYERIREERRRGRGVVQAIEFGYKEASRTIFEANVTHAI
AGGIMLALGSGPVKGFAIVLLIGIATSVFTAVTFTRVLVSGWVRRTRPTDIHI