Protein Info for GFF3179 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: iron-chelator utilization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF08021: FAD_binding_9" amino acids 23 to 133 (111 residues), 117.4 bits, see alignment E=4.4e-38 PF04954: SIP" amino acids 143 to 254 (112 residues), 88.9 bits, see alignment E=3.8e-29

Best Hits

Swiss-Prot: 73% identical to YQJH_ECOLI: NADPH-dependent ferric-chelate reductase (yqjH) from Escherichia coli (strain K12)

KEGG orthology group: K07229, (no description) (inferred from 97% identity to sea:SeAg_B3400)

MetaCyc: 73% identical to NADPH-dependent ferric-chelate reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6555 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]

Predicted SEED Role

"iron-chelator utilization protein" in subsystem Ton and Tol transport systems

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF3179 iron-chelator utilization protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTTSSVRYPQRVRNELRFRELIVLRVERISAGFQRIVLGGEALDGFISLGFDDHTKVFFP
EPGCRFTPPTVTEEGIIWGEGVRPVSRDYTPLYDEARRELALDFFIHDGGVASRWAMEAR
EGDTLTIGGPRGSLVVPEEYACQVYVCDESGMPALRRRLESLSRLPVRPAVTALVSIQDA
AYRDYLAHLTDITVEYVVGGDEQAMQTRLSQLTIPESDYFIWITGEGKTVKRLSQCFEKG
FDPHLVRAAAYWHRK