Protein Info for GFF3178 in Xanthobacter sp. DMC5

Annotation: 30S ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 17 to 139 (123 residues), 222.9 bits, E=3.8e-71
• PF00164: Ribosom_S12_S23
  • amino acids 34 to 139 (106 residues), 135.7 bits, E=2.7e-44

Best Hits

Swiss-Prot: 100% identical to RS12_XANP2: 30S ribosomal protein S12 (rpsL) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 99% identity to azc:AZC_2559)

MetaCyc: 76% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Protein Sequence (139 amino acids)

>GFF3178 30S ribosomal protein S12 (Xanthobacter sp. DMC5)
MKDAAKAADQDEAKAYMPTINQLIRKPREAQKARDKAPALQASPQKRGVCTRVYTTTPKK
PNSALRKVAKVRLTNSYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDT
QGVKNRKQRRSKYGAKRPK