Protein Info for GFF3175 in Sphingobium sp. HT1-2

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 214 to 230 (17 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 298 to 339 (42 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 400 (386 residues), 169.6 bits, see alignment E=4.9e-54

Best Hits

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF3175 Na+/H+ antiporter (Sphingobium sp. HT1-2)
MHPVELFELLVAMLLAIIALHYAAHRLGLPPAVALLTGGTLLAFLPGLPVISLDPELVLV
IFLPPLLMDGAWFIALGHLRRHLIGIMSLAIGAVIFTTLVVAAVAHALMPSLPWAACAAL
GAIVSPPDAIAARAVLQRVHLPRRLSVLLEGESLFNDASGLVLFRFAIAAVATGSFSAVA
GLESFILLAVGGLIVGGAIGAIWVLLVRRLGDDYLMIASSMLVPWSAYLLGEAFHVSGVI
ATVAAGLICGWYQHIVWSASVRMRGTAFWAVMIFLMEATVFMLIGSSLRGVVDRVGGFAV
VLDNMAVPVLLILLALTAARFVWVFGSDAIIMLLRAMGLLRYSPVGPRGATVLGWAGMRG
VVTLAVALSVPEGFPGRDFLLVAAFGVILGTVLIQGTTLAC