Protein Info for PS417_16240 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 19 to 160 (142 residues), 91.7 bits, see alignment E=6.3e-30

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 99% identity to pfs:PFLU3746)

MetaCyc: 36% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter ATP-binding subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0H9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PS417_16240 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MSLTLEHVSRVVEGQTWIDDATLRFEAGSFNVLLGRTLSGKTSLMRLMAGLDKPNSGRIL
MNGVDVTQKPVRLRNVSMVYQQFINYPTMTVFENIASPLRQAGVSNELIQSKVLETAKML
RIEKFLQRHPLELSGGQQQRTAMARALVKDAELILFDEPLVNLDYKLREELRQEMRELFA
ARHTIAIYATTEPNEALALGGTTTILHEGRVIQSGKAAEVYHQPRTVLAAELFSEPPINL
MPGRISGNEVSFANFVHFPLNVDLRPIGEGEFRFGVRPSHISLVPSNDDDLELAVTVEVA
EISGSETFLHVRSEHFLLVLHLPGVHEYDVDAPIRVYIPTHKLFVFDGQGRLVQAPGRRV
ARVA