Protein Info for GFF317 in Sphingobium sp. HT1-2

Annotation: tRNA t(6)A37-methylthiotransferase (EC 2.8.4.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01579: MiaB-like tRNA modifying enzyme" amino acids 6 to 387 (382 residues), 422.6 bits, see alignment E=2.2e-130 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 6 to 407 (402 residues), 323.9 bits, see alignment E=1.5e-100 PF00919: UPF0004" amino acids 6 to 88 (83 residues), 56.8 bits, see alignment E=1.9e-19 PF04055: Radical_SAM" amino acids 133 to 303 (171 residues), 80 bits, see alignment E=2.4e-26

Best Hits

Swiss-Prot: 55% identical to MTAB_RICPR: Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB (mtaB) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: None (inferred from 70% identity to swi:Swit_2929)

Predicted SEED Role

"tRNA-t(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF317 tRNA t(6)A37-methylthiotransferase (EC 2.8.4.5) (Sphingobium sp. HT1-2)
VPGPDIITLGCRLNIAESEAIREMAGAQDDLIVVNSCAVTAEAVRQTRQAIRRAKRERPD
ARILVTGCAAQTEPQTFAAMAEVDGVIGNREKLEAAAFAPVAAKVNVSDIMAVRDTAPHM
ASAFAEHARAFLEVQNGCDHRCTFCIIPYGRGNSRSVPAGAVIDKAKQLVDAGYGEIVLT
GVDVTSYGPDLPGSPSLGQLVERLLRHVPNLPRLRLSSIDSVEIDERLFDLIAHEPRMMP
HLHLSLQAGDDMILKRMKRRHGRADAVRIVERVKAARPDISIGADIIAGFPTEDEVMFAN
SLALVADCDIVHGHIFPYSPRTGTPAARMPQLDRATIKARAALLRDACTAQRDAWLARLV
GTRQSVLVERNGLSGHAENFAPVRFTTPQPPSTIVAARISGLENGALIAQEAQ