Protein Info for GFF3167 in Sphingobium sp. HT1-2

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 92 to 108 (17 residues), see Phobius details amino acids 114 to 130 (17 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 322 to 485 (164 residues), 146.9 bits, see alignment E=4.6e-47 PF00990: GGDEF" amino acids 326 to 482 (157 residues), 161.4 bits, see alignment E=1.7e-51 PF00563: EAL" amino acids 504 to 737 (234 residues), 222.8 bits, see alignment E=4.4e-70

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (758 amino acids)

>GFF3167 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Sphingobium sp. HT1-2)
VIALSRISGEFQSPEREAAFQADRLPESRRHAHLLFALSALLNTLFLLSDWRLAGTAHFW
VAVPARLVVVFWSLVSLGLCRYMHSFKAVERICFAWQCITAIGVAFLVSSRSDIAIFVLV
MLPLVFYLVVPTSFRGNVGGGLGCGVALLIGYLAPAPLSPTMPGMIMAVLMLHCGMWIAI
ARTNRLQRLEWTASQDAQAARVALAANGEALERLFMTVPLPLIVIRDDGTVLRMNDSATR
NLGTADDVARLALIVDHAPPLRLLDRLTRGDSIDNDECCLANDEGIIRDVLLGARPILLA
GEQCILASIVDITDRKQAERHLAHLAMTDALTGLANRSHFMASLMQAAQSTERSGGQMAV
VLIDVDEFKRINDSAGHDAGDALLCAVAERLRDSVRPADMIARMGGDEFAVILTRLRGLA
DLDTILSRMIARLHMPLRHGGRDIDCRVSMGVALYPDHAGDMIDLMKHADIALYEAKNSG
RGRACLFEPGLLESWQTEARMLERARDALAHAQPVPWYQPKVDLQDGRVIGFEALLRCVR
PDGTLMMPDQILAAFEHPELGRKITERMIDQVLADCRAWISAGIDFGHVAVNVPGVELHD
RAFPDRLLTRLAHADVEPRRIELEVTESVFLGRNVDVVERNLQRLSQAGMAIALDDFGTG
YASLSHLKQFPIDVIKIDKGFVRDLETDPDDAAIVRTVLNLAYSLGVKTVAEGVETIEQL
EYLRSGGCHYGQGYYWSAAVPASQLPSFLEPSRFARRS