Protein Info for GFF3166 in Sphingobium sp. HT1-2

Annotation: SSU ribosomal protein S12p (S23e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 14 to 136 (123 residues), 219.1 bits, E=5.7e-70
• PF00164: Ribosom_S12_S23
  • amino acids 31 to 136 (106 residues), 135.2 bits, E=3.8e-44

Best Hits

Swiss-Prot: 96% identical to RS12_SPHAL: 30S ribosomal protein S12 (rpsL) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 99% identity to sch:Sphch_1834)

MetaCyc: 76% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Protein Sequence (136 amino acids)

>GFF3166 SSU ribosomal protein S12p (S23e) (Sphingobium sp. HT1-2)
VASGKVTEKVKGFMPTINQLVRKGRELQKTKSKVPAMDANPQKRGVCTRVYTTTPKKPNS
ALRKVAKVRLVNQREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGV
KDRKQSRSKYGAKRPK