Protein Info for PS417_16180 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 12 to 14 (3 residues), see Phobius details transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 319 (302 residues), 112.6 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 67% identical to SOTB_PSESM: Probable sugar efflux transporter (sotB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K08159, MFS transporter, DHA1 family, L-arabinose/isopropyl-beta-D-thiogalactopyranoside export protein (inferred from 97% identity to pfs:PFLU3734)

Predicted SEED Role

"Sugar efflux transporter SotB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJB5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PS417_16180 MFS transporter (Pseudomonas simiae WCS417)
MSLSAATPQANWQPVIALALAAFVFNTTEFVPVGLLSAIGASFDMPVSSVGLMLTIYAWI
VSLTSLPVMLLTRNVERRKLLIVLFCMFIVSHILSSVATSFGILMLSRIGIALSHALFWS
ITASLAVRLAPEGKQVQALGLLATGTSLAMVLGIPLGRLLGEAMGWRTTFLVIGAFAAAL
VFWLARTLPLLPSQNSGSLRSLPLLFKRPALVALYVLTAMTVTAQFTAYSYIEPFVEGVA
GMSGSAVTLILLVFGGAGIIGSLLFSLVHRFNPHVFVVGAVFILAACLALLLPLSGAESY
LVVLSVFWGMAIMGFGLAMQSKVLVLAPDATDVAMAMFSGIYNIGIGGGALVGSWVGSQF
GFAWIGAAGGLLAALALIGYCLAIRRFGQGVARA