Protein Info for GFF3161 in Sphingobium sp. HT1-2

Annotation: LSU ribosomal protein L3p (L3e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR03625: 50S ribosomal protein uL3" amino acids 4 to 204 (201 residues), 275.8 bits, see alignment E=1.2e-86 PF00297: Ribosomal_L3" amino acids 85 to 181 (97 residues), 60.8 bits, see alignment E=6e-21

Best Hits

Swiss-Prot: 83% identical to RL3_SPHAL: 50S ribosomal protein L3 (rplC) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02906, large subunit ribosomal protein L3 (inferred from 95% identity to sjp:SJA_C1-06270)

MetaCyc: 52% identical to 50S ribosomal subunit protein L3 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L3p (L3e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF3161 LSU ribosomal protein L3p (L3e) (Sphingobium sp. HT1-2)
MRTGVIAKKVGMTRLFQDDGRHVPVTVLSLEGTQVVARKEVERDGYVALQLGAGVAKAKN
VAKPQRGHFAKAEVEPKARLVEFRVAEDALLDVGAEIAADHFVAGQLVDVAGHTQGKGFA
GAMKRWGFGGMRATHGVSISHRAHGSTGNRQDPGRVFKNKKMAGHMGDRERTQQNLEIVR
TDVERGLLFVKGSVPGAKGTWLTVSDAVKVPRHADAPYPASLKQAANSNAAPAETPAEAA
APEATEGQEG