Protein Info for GFF3158 in Xanthobacter sp. DMC5

Annotation: Ubiquinone biosynthesis O-methyltransferase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 361 to 381 (21 residues), see Phobius details PF02353: CMAS" amino acids 118 to 380 (263 residues), 271.3 bits, see alignment E=3.6e-84 PF01728: FtsJ" amino acids 162 to 246 (85 residues), 23.9 bits, see alignment E=1.4e-08 PF13489: Methyltransf_23" amino acids 172 to 338 (167 residues), 34.9 bits, see alignment E=4.9e-12 PF13847: Methyltransf_31" amino acids 173 to 279 (107 residues), 31.5 bits, see alignment E=5.6e-11 PF13649: Methyltransf_25" amino acids 178 to 272 (95 residues), 53.4 bits, see alignment E=1.4e-17 PF08241: Methyltransf_11" amino acids 180 to 276 (97 residues), 40.5 bits, see alignment E=1.5e-13 PF08242: Methyltransf_12" amino acids 180 to 273 (94 residues), 38.6 bits, see alignment E=6.1e-13

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 95% identity to xau:Xaut_4728)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF3158 Ubiquinone biosynthesis O-methyltransferase, mitochondrial (Xanthobacter sp. DMC5)
MRLLSHLLSRFVEKGQLTVITADGQRYVFGSGKDGPSVTVRMHDKKLERDLFFNPELVAA
EAYMDGRLSFEDGAGAFELLNLFSVNRKGLGSHPVQQALRKAWRSVRRFQQANPVGKAKE
NVSSHYDHPADFYRLWLDETMAYSCAYFTHPDEPLADAQRNKFRHIAAKLNISPGMRVAE
IGSGWGGLAIYMAKECGAQVTAINVSPEQLAESRRLAEAAGVAGSIDFREVDYRNLTGKY
DRVVSIGMMEHVGVAHFDEYFTTIRNLLDTGGFALIHAIGRMSPPGTTAPFIRKYIFPGG
YVPALSEVFASTERTHLWVDDCEVLRLHYYWTIRAWRRNFMARRAEADAMMGERFGRMWE
FYLAAVELGFLHGSNMVFQLLLSEKRDDVPVIRDYIVDAERALAARERR